SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007331 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007331
Domain Number 1 Region: 57-197
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.27e-25
Family Voltage-gated potassium channels 0.0045
Further Details:      
 
Domain Number 2 Region: 2-39
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000549
Family Voltage-gated potassium channels 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007331   Gene: ENSOGAG00000008190   Transcript: ENSOGAT00000008194
Sequence length 269
Comment pep:known_by_projection scaffold:OtoGar3:GL873687.1:3824946:3877093:-1 gene:ENSOGAG00000008190 transcript:ENSOGAT00000008194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVS
QTKIRIISTIIFILFGCVLFVALPAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGS
DIEYLDFYKPVVWFWILVGLAYFAAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVT
AEFKETRRRLSVEIYDKFQRATSIKRKLSAELAGNHNQELTPCRRTLSVNHLTSERDVLP
PLLKTESIYLNGLTPHCAGEEIAVIENIK
Download sequence
Identical sequences H0WXX4
ENSOGAP00000007331 ENSOGAP00000007331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]