SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007340 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007340
Domain Number 1 Region: 39-284
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.89e-88
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000332
Further Details:      
 
Domain Number 2 Region: 285-488
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 8.5e-46
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00013
Further Details:      
 
Domain Number 3 Region: 620-800
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.71e-32
Family AlaX-like 0.058
Further Details:      
 
Domain Number 4 Region: 545-620
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000000494
Family AlaX-M N-terminal domain-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007340   Gene: ENSOGAG00000008197   Transcript: ENSOGAT00000008204
Sequence length 985
Comment pep:known_by_projection scaffold:OtoGar3:GL873550.1:14844595:14857823:-1 gene:ENSOGAG00000008197 transcript:ENSOGAT00000008204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVAAAAERLRRAIQRSSPWRRPNRRPLSSKPPPTQASAVRDAFLSFFRDRHGHRLVP
SASVRPRGDPTLLFVNAGMNQFKPIFLGTVDPRSEMAGFRRVANSQKCVRAGGRHSDLED
VGRDLSHHTFFEMLGNWAFGGEYFKEEACSMAWELLTQVYGIPEERLWVTYFGGDPKTGM
QPDLESRDIWLSLGVPANRVLSFGPQENFWEMGETGPCGPCTEIHYDLAGGVGAPQLVEL
WNLVFMQHNRETNGSLQPLPQQHVDTGMGLERLVAVLQGKHSTYDTDLFSPLLHAIYQGC
EAPPYLGRVGVADEARTDMAYRVVADHIRTLSVCIADGVSPGMSGAPLVLRRILRRAVRF
STEVLQAPPGFLGSLVPVVVETLGDAYPELQKNSAQIAKLVSEDEEAFLASLQRGRQIID
RTVRQLGPSDVFPAEVAWSLSLSGNLGLPLDLVELMLEEKGVQLDSAGLERLAQEEAQHR
AQQAEPIQDQGLRLNIHALGDLQRRGVPPTDDSPKYNYSLRPNGDYEFHTCEAQVLQLYT
EDGTAVASVGKGQHCGLLLDRTNFYAEQGGQASDRGYLVREGQQDVLFPVTRAQVCGGFI
LHEVIAPECLQVGDQVQLHVDKAWRLGCMEKHTATHLLSWALQQALGPGTEQRGSHLNPE
RLRFDVATQAPLTSEQLRAVERTVQEVVGQDEAVYMEEVALALTAQVPGLRSLDEVYPDP
VRVVSVGVPVAQALDPASQAALQTSVELCCGTHLLRTGAVRDLVITGERQLSKGTTRLLA
VTGEQAQQARELGQSLAQEVEAAAERLSRGNQDVMAAQQLSKDVGRLTDAVDTTMMPQWQ
RRELQATLKVLQRHANTAIRKLEMGQAAKKTQELLERHSKKPLIVDTVSAESLSVLVKVV
RQLCKQAPSTSVLLLSPQPTGNVLCACQVAQGAMPTFTADAWALAVCNHMRGKAWGSQVV
AQGIGSTGDLEAALSTARAYALSQL
Download sequence
Identical sequences H0WXY2
ENSOGAP00000007340 ENSOGAP00000007340 XP_003789281.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]