SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007357 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007357
Domain Number 1 Region: 42-199
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000379
Family SMI1/KNR4-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007357   Gene: ENSOGAG00000008218   Transcript: ENSOGAT00000008221
Sequence length 296
Comment pep:known_by_projection scaffold:OtoGar3:GL873531.1:15128648:15151403:1 gene:ENSOGAG00000008218 transcript:ENSOGAT00000008221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMEKTSPPLLGCNKPHLEKLTLGITRILESSPGVTEVTIIEKAPAERHMISSWEQKNNCT
MPEDVKNFYLMTNGFHMTWSVKLDEHTIPLGNMAINSISKLTQLNQSSMYSLPNAPTLAD
LEDDTHEDSEDQPEKPHFDSRNVIFELDSCNGNGKVCLVYKSGKPALAQDTEIWFLDRAL
YWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFNMYKPITYNTNLLTEETD
SFVNKLDPSKVFKSKNKILIPKKKAPVQPASGQKGPSGSSGSSTSKPSGPGNPVRK
Download sequence
Identical sequences H0WXZ9
ENSOGAP00000007357 ENSOGAP00000007357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]