SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007448 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007448
Domain Number 1 Region: 1026-1181,1219-1298
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.41e-41
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 1349-1546,1573-1598
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.46e-37
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 3 Region: 572-719,753-800
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.31e-30
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 4 Region: 130-275,379-448
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.18e-29
Family Voltage-gated potassium channels 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007448   Gene: ENSOGAG00000008312   Transcript: ENSOGAT00000008320
Sequence length 1826
Comment pep:novel scaffold:OtoGar3:GL873537.1:15925905:15952993:1 gene:ENSOGAG00000008312 transcript:ENSOGAT00000008320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPSLATLVPLGPECLRPFTRESLAAIEQRAVEEVARQERNRQMEIEEPERKPRSDLEA
GKNLPLIYGDPPPEVIGIPLEDLDPYYSDKKTFIVLNKGKAIFRFSATPALYLLSPFSII
RRGAIKVLIHALFSMFIMITILTNCVFMTMSDPPPWSKNVEYTFTGIYTFESLIKMLARG
FCIDDFTFLRDPWNWLDFSVIVMAYVTEFVDLGNISALRTFRVLRALKTITVIPGLKTIV
GALIQSVKKLSDVMILTVFCLSVFALVGLQLFMGNLRQKCVRWPPPFNDTNITWYGNDTW
YDNDTWYSNDTWHGSDTWISNDTWAGNYTFDWEAYISDEGNFYFLEGSNDALLCGNSSDA
GHCPEGYECIKAGRNPNYGYTSYDTFSWAFLALFRLMTQDYWENLFQLTLRAAGKTYMIF
FVVIIFLGSFYLINLILAVVAMAYAEQNEATLAENKEKEEEFQQMLEKFKKHQEELEKAK
AAQALEGGEADGDPAHGKDCNGNLDASTGEKGAPRQSCSADSGISDAMEELEEAHQKCPP
WWYKCAHKVLIWNCCVPWVKFKNIIHLIVMDPFVDLGITICIVLNTLFMAMEHYPMTEHF
DNVLSVGNLVFTGIFTAEMVLKLIALDPYEYFQQGWNVFDSIIVTLSLVELGLANVQGLS
VLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY
KECVCKIASDCSLPRWHMHDFFHSFLIVFRILCGEWIETMWDCMEVAGQPMCLTVFLLVM
VIGNLVVLNLFLALLLSSFSADSLAASDEDGEMNNLQIAIGRIKWGIGFAKAFLLGLLHG
KILSPQDIMLRLGKPGGAEEAEEAGESDPKDEKEPLPEEDLKKDNHILNHVGLADGPPPS
IELDHLNFINNPYLTIQVPIASEESDLEMPTEEETDTFVSVQPGDSEKQLKPLYDGDSSV
CSTADYKPPEEDPEEQAEENPEGEQPEECFTEACVQRYPCLTVDISQGRGKMWWTLRRAC
FKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIRTILEYADKVFTYVFILEMLLKW
VAYGFKVYFTNAWCWLDFLIVDVSIISLVANWLGYSELGPIKSLRTLRALRPLRALSRFE
GMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCINTTTSERFDISEVN
NKSECESLMHTGQVRWLNVKVNYDNVGLGYLSLLQVATFKGWMDIMYAAVDSREQEQQPQ
YEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGKDIFMTEEQKKYYNAMK
KLGSKKPQKPIPRPQNKVQGMVYDLVTNQVFDIAIMILICLNMVTMMVETDDQSQLKVDI
LYNINMIFIIIFTGECLLKMLALRQYFFTVGWNIFDFVVVILSIVGLALSDLIQKYFVSP
TLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNF
AYVKKESGIDDMFNFETFGNSIICLFEITTSAGWDGLLNPILNSGPPDCDPDLENPGSSV
KGDCGNPSIGICFFCSYIIISFLIVVNMYIAIILENFNVATEESSEPLCEDDFEMFYETW
EKFDPDATQFIAYSRLSDFVDTLQEPLRIAKPNKIKLITLDLPMVPGDKIHCLDILFALT
KEVLGDSGEMDALKQTMEEKFMAANPSKVSYEPITTTLKRKHEEVCAIKIQRAYRRHLLQ
RSVKQASYMYRHSQDSNGDDAPEKEGLIANTMNQMYGHENSNSSVHSEGNAQPAVGLVPV
SPSDAALPPSPPPGQTVRPGVKESLV
Download sequence
Identical sequences H0WY76
ENSOGAP00000007448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]