SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007472 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007472
Domain Number 1 Region: 83-191,301-419,461-482,531-635
Classification Level Classification E-value
Superfamily RNI-like 3.57e-16
Family Cyclin A/CDK2-associated p19, Skp2 0.065
Further Details:      
 
Domain Number 2 Region: 8-65
Classification Level Classification E-value
Superfamily F-box domain 0.0000000262
Family F-box domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007472   Gene: ENSOGAG00000008341   Transcript: ENSOGAT00000008347
Sequence length 708
Comment pep:known_by_projection scaffold:OtoGar3:GL873611.1:966654:1006215:1 gene:ENSOGAG00000008341 transcript:ENSOGAT00000008347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNDDDTHPAGMAGGTHLLGFSDEILLHILSHVPSIDLILNVRCTCRKLAALCLDKSLVH
TVLLQKDYQASEDKVKQLVKEIGRDIQQLSLAGCYWLSGSTVEHVARCRSLVKVNLSGCH
LTSLRLSKMLSALQHLRSLAIDVSPGFDASQLSGECKATLSRVRELKQTLFTPSYGVVPC
CISLEKLLLYFEILDRTREGAILSGQLMVGQSNVPHYQNLRVFYARLAPGYINQEVVRLY
LAVLSDRTPENLHAFLISVPGSFAESGATKNLLDSMARNVALDALQLPKSWLNGSSLLQH
MKFNNPFYFSFSRCTLSGGHLIQRVINGGKDLRSLASLNLSGCVHCLSPDSLLRKAEDDI
DSSILETLVVSCCNLRHLNLSAAHHHSSEGLGRHLCQLLSRLRHLRSLSLPVCSVADSAP
RADRVPAQPVMHAVPRGFGKKVRIGVQSCPNPFLGQTVPQPSSVFWSLLKNLPFLEHLEL
IGSNFSSAMPRNEPAIRNSLPPCSRAQNVGDSEVAAIGQLAFLRHLTLAQLPSVLTGSGL
VSIGLQCQQLQSLSLANLGMMGKVVYMPALSDMLKHCKQLKDLRLEQPYFSANAQFFQAL
SQCPSLQRLCLVSRSGTLQPDAVVAFMACCLQVVVCHMFTGESLATCKSLQQSLLRSFQA
ERPALNVVIFPLLHEGLTDVIRDVPMVHLDEITLFKSRVAEEPPNLWW
Download sequence
Identical sequences H0WY99
XP_003795486.2.62490 ENSOGAP00000007472 ENSOGAP00000007472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]