SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007497 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007497
Domain Number 1 Region: 370-453
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.54e-29
Family Forkhead DNA-binding domain 0.0000145
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000007497
Domain Number - Region: 213-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0143
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007497   Gene: ENSOGAG00000008367   Transcript: ENSOGAT00000008373
Sequence length 583
Comment pep:known_by_projection scaffold:OtoGar3:GL873534.1:16079279:16170618:1 gene:ENSOGAG00000008367 transcript:ENSOGAT00000008373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQVLLQQQQALMLQQQQLQEFYKKQQEQL
QLQLLQQQHAGKQPKEQQQVATQQLAFQQQLLQMQQLQQQHLLSLQRQGLLTIQPGQPAL
PLQPLAQGMIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNPH
ASTNGQLSVHTPKRESLPHEEHPHSHPLYGHGVCKWPGCEAVCEDFQSFLKHLNSEHALD
DRSTAQCRVQMQVVQQLELQLAKDKERLQAMMTHLHVKSTEPKAAPQPLNLVSSVTLSKS
ASEASPQSLPHTPTTPTAPLTPVTQGPSVITTTSMHTVGPIRRRYSDKYNVPISSADIAQ
NQEFYKNAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVR
HNLSLHKCFVRVENVKGAVWTVDEVEFQKRRPQKISGNPSLIKNMQSGHAYCTPLNAALQ
ASMAENSIPLYTTASMGNPTLGNLASAIREELNGAMEHTNSNESDSSPGRSPMQAVHPVH
VKEEPLDPEEAEGPLSLVTTANHSPDFDHDRDYEDEPVNEDME
Download sequence
Identical sequences H0WYC0
ENSOGAP00000007497 ENSOGAP00000007497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]