SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007517 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007517
Domain Number 1 Region: 112-172,292-375
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.75e-33
Family Regulator of G-protein signaling, RGS 0.0076
Further Details:      
 
Domain Number 2 Region: 370-509
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.12e-28
Family Regulator of G-protein signaling, RGS 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007517   Gene: ENSOGAG00000008388   Transcript: ENSOGAT00000008395
Sequence length 661
Comment pep:known_by_projection scaffold:OtoGar3:GL873565.1:2106510:2182971:-1 gene:ENSOGAG00000008388 transcript:ENSOGAT00000008395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAGPSPRQSPRTLRPDPGPAMSFFRRKVKGKEQEKTSDGKSIRASVSVHSPQKSTKNH
ALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEAAHFGDLGRSCLDYQTQETKS
SLSKTLEQVLHDTVVLPYFIQFMELRRMEHLVKFWLEAESFHSTTWSRIRAHTLNTVKQS
SLAEPVSPSKKHESTASFVTESLDKRLEDSSSAQLLMTQSEGIDLNNRTNSTQNHLLLSQ
ECGSAHSLHLQMARAGTHQVSMETQESSRFIVANRNNPSSPLKDLSGKLMKSIEQDAVNT
FTKYISPDAAKPIPITEAMRNDIIAKICGEDGQVDPNCFVLAQSIVFSAMEQEHFSEFLR
SHHFCKYQIEVLTSGTVYLADILFCESALFYFSEYMEKEDAVNILQFWLAADNFQSQLAA
KKGQYDGQEAQSDAMILYDKYFSLQATHPLGFDDVVRLEIESNICREGGPLPNCFTTPLR
QAWTTMEKVFLPGFLSSNLYYKYLNDLIHSVRGDEFLGGNISLAAHGSVGPPDEANAGGS
DSSTSQSSVKKASIKILKNFDEVIIVDAASLDPESLYQRTYAGKMTFGRVSDLGQFIRES
EPEPDVKKSKGSMFSQAMKKWVQGSTDEAQEELAWKIAKMIVSDVMQQAQCDQPVERSTK
L
Download sequence
Identical sequences H0WYD5
XP_003791112.1.62490 ENSOGAP00000007517 ENSOGAP00000007517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]