SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007535 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007535
Domain Number 1 Region: 58-133
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.27e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007535   Gene: ENSOGAG00000008412   Transcript: ENSOGAT00000008415
Sequence length 222
Comment pep:known_by_projection scaffold:OtoGar3:GL873587.1:5913878:5936483:-1 gene:ENSOGAG00000008412 transcript:ENSOGAT00000008415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKSKKNNSSSRST
HNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQID
QLQREQRHLKRQLEKLGIERIRMDSIGSTVSSERSDSDREIDVDVDVESTDYLAGDLDWS
SSSVSDSDERGSMQSLGSDEGYSSASIKRIKLQDSHKACLSL
Download sequence
Identical sequences H0WYF1
ENSOGAP00000007535 ENSOGAP00000007535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]