SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007536 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007536
Domain Number 1 Region: 797-925
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.45e-20
Family Regulator of G-protein signaling, RGS 0.0045
Further Details:      
 
Domain Number 2 Region: 969-1084
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.62e-19
Family Regulator of G-protein signaling, RGS 0.0021
Further Details:      
 
Domain Number 3 Region: 609-734
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.62e-18
Family Regulator of G-protein signaling, RGS 0.0034
Further Details:      
 
Domain Number 4 Region: 363-462
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000155
Family Regulator of G-protein signaling, RGS 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007536   Gene: ENSOGAG00000008411   Transcript: ENSOGAT00000008417
Sequence length 1214
Comment pep:known_by_projection scaffold:OtoGar3:GL873523.1:26609424:26692527:1 gene:ENSOGAG00000008411 transcript:ENSOGAT00000008417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HFHSFILQTFSEAIRFNVDYGVFEVINNAPQLLEKQLKKILQNQQPRNPIYDVVRREKHD
VKPGEVNVPGEGETINVNYSIMCLSREEGIKWIKKERLPAFLESDCYFEYRLAKLVSQAR
WSKSGMSFTLGTSFSPWVLKKPRSSLPPPTEEDNLASYTQTKDWFSLAKKSQQTVSTFSS
PSCTPHSRIESPVLSSVSESAIFSDGVHPRTQRGPSKTKLISEFEEEEDDEEEEGSVSLQ
DTPSQALLRIYIEKFKDGESLHFSTCEDFLNSYIHFILSSAIQKMTGESHMEREPFVDYP
GYINFSNITRVSFDDTLESFPEKAKEGSDETFEETISKSDSTGPQSRPDWRISHRMYEIG
TRKEFERFKKFLKGTLGERYWWLWMDIERLKVLKDSGRLQRHLEKMKKSYLVSSGNCYLS
TEILSKFKLLDSSQWTQEHLTNIQSEVVKPLLLYWGPRFCVTRSASAKSANAELKLWHFR
QEKPRKDIDPFPQMATLLPLRPKSCIPQTSEIQKEEFSLSQSPKSPRKAHAIKTTTQKLW
KSESLYPISAKNKNDAFEKGLRSMSESKRVVRLTSFTDISECLKPELDRRYTYSEEPQVK
SMLDVGTLGGGDMESLLQSLYVENRAGFFFTKFCEHSGNKLWKNSVYFWFDLQAYHQLFY
QETLQPFKVCKQAQYLFATYIAPSATLDIGLRQEKKKDIYMKIHPPFEDLFDTAEEYILL
LLLEPWMKMIKSDQLTYKKVDLVEETRQLDSTSFRKLQALHKEKAKDTSVGIRTGALSLS
NVSKQTEYWNNVPEEYKHFNFNDLLNNKLEFEHFRQFLESHSSSMDLMCWIDIEQFRRLI
YTNRNQMEAKSIYIKNKYLNKKYFFGPNSPATPHQQDQIMYLSGGWGKILHDQLDASVLV
EIQRHVLNRLENVWLPLFLASEQFAARQKIKVQMKDIAEELLQQKHEMKIGVWKPVESKW
ISSSGEIIAFRKALLNPVTARQFQRFMALKGDLLENGVLFWQEVQKYKDLCHSHCDPSVI
QKKIKTIINCFINSSIPPALQIDIPEEQAQKIIERRKELGPYVFREAQMTIFGVLFKFWP
QFCEFRKNITDEKIMSVLERRQDYTKQKKKVASLDDERLGKDALKQYTSAAASSVKTPAA
VSESFLGLQAYGRQPSWCYSKYIEALEQERILLKVQEELEKRLFTAGAASPTNSKRTPST
LSLKKNLSILRSKK
Download sequence
Identical sequences H0WYF2
ENSOGAP00000007536 ENSOGAP00000007536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]