SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007539 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007539
Domain Number 1 Region: 624-678
Classification Level Classification E-value
Superfamily RING/U-box 0.00000653
Family RING finger domain, C3HC4 0.065
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000007539
Domain Number - Region: 504-535
Classification Level Classification E-value
Superfamily F-box domain 0.000484
Family F-box domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007539   Gene: ENSOGAG00000008418   Transcript: ENSOGAT00000008420
Sequence length 704
Comment pep:known_by_projection scaffold:OtoGar3:GL873523.1:26535179:26550974:1 gene:ENSOGAG00000008418 transcript:ENSOGAT00000008420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFKDIDERSCLEAYITLPSESSRFADETEILKMSQRHSGQASMGAGNEMDSPTVNFKYC
NFKDFCSVSSFQDSAYDELRSSSFDNTDEEFFGNKDTGRTLIREYPETSRLILPYPSESL
TPQKRSVFPRKEKDRSPELCETPKISGKKCLPRRRLNVSFSCLKGDSESQNSSLETGVSQ
AQNLEKNIISSASGFPRQNNFSSLVTSTLKTEDVTLSSQKLRLNFSQQKTSTVDNSQDDC
NLFEVECISPIQGNNFKDSVIHDFSDSSLCINDENTYPELGSSISGTTCGTDEDIFVTPI
SNLVANIKFNASQTPSSTEVRGNISTPEDSGFNSLSLDKSEDSLSDQEGSIQELVQKHKG
TLKVGDTIRKARRLGRTRRLSTLREQGSQSETEEEEQSIHSNSEPRLAAAFDISDSPLGS
DKSGDLTLSFKNLSKTPALQLVHELFMKSKRKRFQQNSAHEFSEEKDGGKIAILQCLLAG
LIGKKMGIEKLDILTELKYRNLRHILAMVLDSLTAESLCSVWKVSRNWREIVIQDKRANR
RRKFYIIQLKTDSEGTVLNVEDAATRLHLLNRSALRSVQAQARPSSSQKEQVSTLSPWGE
VLTPLASSSVTPLSSKQEEYVKVAKTLFIDEAIKPCPRCQSPAKYQPYKKRGLCSRTACG
FDFCVLCLCAYHGSEECSRGAAKPRNRKDALPGSAQSKRNLKRL
Download sequence
Identical sequences H0WYF5
ENSOGAP00000007539 ENSOGAP00000007539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]