SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007576 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007576
Domain Number 1 Region: 549-955
Classification Level Classification E-value
Superfamily RNI-like 1.57e-76
Family 28-residue LRR 0.000031
Further Details:      
 
Domain Number 2 Region: 1-90
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000153
Family Pyrin domain, PYD 0.027
Further Details:      
 
Domain Number 3 Region: 124-232,265-328
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000396
Family Nucleotide and nucleoside kinases 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007576   Gene: ENSOGAG00000008458   Transcript: ENSOGAT00000008461
Sequence length 956
Comment pep:known_by_projection scaffold:OtoGar3:GL873783.1:131392:159842:-1 gene:ENSOGAG00000008458 transcript:ENSOGAT00000008461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDQYQLEEFRLHLRPLERSWQVPDVNITQLSQARFPEIPWADLRAADPVNLFCLLKEHFS
EWQLWEVVLSILGKMNLTSLCEQVREEMKNHRREFRKRLKTNILALWDNIPCPEGHIYIC
NTSEEEHKEMQRLLDPNGTKAQAQTIVLQGRAGTGKTTLVLKAMLHWAEGTLFQHRFSYI
FYLSCLKMKNMQEITFADLLCWDDKPNSEALIEEFVSQPEKLLFVVDGFEEMTIPEPGPH
HLEDSLPHIGWHEKLPVTKILLSLLKKELVPMATLLITIRAPYVKNLTSLLVNPCFVCVT
GFAEEDREVYFSSCLGDQKEAKAMLEQVKRNEALFNSCSAPMVCWTICSCLKQLKARSSD
LQTTTSLYACFFSNLFSTADMGLPDESLPGQWYTLCALAAEGMWSLNFTFGEEDAQYQLL
EVPFIDSLFHLDILQAVRDHENCITFTHPSFQEFFAAMFYVLEEPRESFHSSSTKHGEMK
IILRAVLVNQESYWTPMVLFFFGLLKKDLVRKLEDTLHCKMSPRIMEELLEWKEELDESE
TASVQFDTQQFFCCLHETQEEDFVKKMLGHVFEADLDILGNTELQVSSFCLKHCERLSKL
RLSVSRPIPEREGEVLEYMNTSDSGKQQWKDICTAFVTNRHLRELDLSNSKLSISSMRSL
CHALRNPRCKLQKLTCKSITPVSVLPKLDLVLHNNKKLTHLNLSSNRLEVGWIFKAVRYP
ACNIKCLCLERCNLSATSCPYLASLLVNVQNMTRLCLGLNKLQDEGAELLCDALTQTTCT
LKRLELWLCQLGAPSCRHLSDALLKNKSLTHLNLSRNHLGDEGVKFLSEALSCSDCSLQC
LNLSGCSFTTEGCQELSDALRHNHNVHVLDIGRNDLGDDGAKLLCEAMRASSCPLTTLGL
EKCNLTAACCQHLSSLLSSHERLAELNLIGNDLEPDGVKTLCEALRKSTCKLQKLG
Download sequence
Identical sequences H0WYI7
ENSOGAP00000007576 ENSOGAP00000007576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]