SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007665 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007665
Domain Number 1 Region: 70-206
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.49e-38
Family Regulator of G-protein signaling, RGS 0.00000507
Further Details:      
 
Domain Number 2 Region: 763-844
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.58e-24
Family DIX domain 0.0000835
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007665   Gene: ENSOGAG00000008556   Transcript: ENSOGAT00000008561
Sequence length 844
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:13077712:13107224:-1 gene:ENSOGAG00000008556 transcript:ENSOGAT00000008561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAVLVTRLPDPSSSFHEDAPRPPVPGEEGETPPCQLGVGKGQVTKPMPVSSNTRRNED
GLGEPEGRASPDSPLTRWSKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPVNPYHVGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEKEGSELAASSRDGAPTQ
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGMGRYSPRSCSPDHHHHHHQQYHSL
LPPGGKLPPTAALPGTCPLLGGKGFVTKQMTKHVHHHYIHHHAVPKTKEEIEAEATQRVR
CFCTAGTEYYCYSKCKSHPKVPEPLPGEQFGGSRGSTLLKRNGKGTEPGLALPTREGGAP
GGAGALQLPGEEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESARVSPGERASRH
HLWGGNSGHPRTTTRAHPFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVASQ
QRDRNHTGTVQAGATPSSTPMLAPEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRM
LKAQSLTLGHFKEQLSKKGNYRRYYFKKASDEFACGAVFEEVWDDETVLPMYEGRILGKV
ERID
Download sequence
Identical sequences H0WYQ7
ENSOGAP00000007665 ENSOGAP00000007665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]