SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007667 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000007667
Domain Number - Region: 27-54,283-305
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0576
Family Voltage-gated potassium channels 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007667   Gene: ENSOGAG00000008561   Transcript: ENSOGAT00000008563
Sequence length 431
Comment pep:known_by_projection scaffold:OtoGar3:GL873606.1:2374716:2383912:1 gene:ENSOGAG00000008561 transcript:ENSOGAT00000008563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLRRLAHLVVFCPFSKGLQGRLPGLRLKSVFLVWLGILVGSWMVYLHYSSYSELCRGR
VCQVVICDQYRKGIISGSICQDLCELHKVEWRTCLSSAPSQQVYSGLWQNKDVTIKCGIE
EVLDSKAGPDAVPRRELVLFDKPTRGTSIKEFQEMTLSFLKANLGDLPSLPALVSQVLLM
ADFNKDSRVSLAEAKSVWALLQRNEFLLLLSLQEKEHASRLLGYCGDLYLTEGVPHGPWH
VAALPPLLRPLLPPALQDTLQQWLGPAWPWRAKIAIGLLEFVEELFHGSYGTFYMCETTL
ANVGYTATYDFKMANLQQVAPEAAVRRFLQGRRCEHSADCTYGRDCRAPCDRLMRQCKGD
LIQPNLAKVCELLRDYLLPGAPADLREELGTQLRTCTTLSGLASQVEAHHSLVLSHLKAL
LWKTISNTKYS
Download sequence
Identical sequences H0WYQ8
ENSOGAP00000007667 ENSOGAP00000007667 XP_003794899.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]