SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007682 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007682
Domain Number 1 Region: 136-332
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.38e-27
Family Voltage-gated potassium channels 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000007682
Domain Number - Region: 385-504
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00374
Family Potassium channel NAD-binding domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007682   Gene: ENSOGAG00000008571   Transcript: ENSOGAT00000008579
Sequence length 1210
Comment pep:known_by_projection scaffold:OtoGar3:GL873606.1:1486097:1543170:1 gene:ENSOGAG00000008571 transcript:ENSOGAT00000008579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CALRRPCAGDGSRGHVDGERPDTTRFKMNDLDSEVLPLPPRYRLRDLLLGDQSFQNDDRV
QVEFYVNENTFKERLKLFFIKNQRSSLRIRLFNFSLKLLTCLLYIVRVLLDDPALGIGCW
GCPKQNYTFNDSSSEINWAPILWVERKMALWVIQVIVAIISFLETMLLIYLSYKGNIWEQ
VFRVSFILEMINTLPFIITIFWRPLRNLFIPVFLNCWLAKHALENMINDFHRAILRTQSA
MFNQVLILFCTLLCLVFTGTCGIQHLERAGGNLSLLTSFYFCIVTFSTVGYGDVTPKIWP
SQLLVVIMICVALVVLPLQFEELVYLWMERQKSGGNYSRHRAQTEKHVVLCVSSLKIDLL
MDFLNEFYAHPRLQDYYVVILCPTEMDIQVRRVLQIPLWSQRVIYLQGSALKDQDLMRAK
MDNGEACFILSSRNEVDRTAADHQTILRAWAVKDFAPNCPLYVQILKPENKFHVKFADHV
VCEEECKYALLALNCICPATSTLITLLVHTSRGQEGQESPEQWQRMYGRCSGNEVYHIRM
GDSKFFREYEGKSFTYAAFHAHKKYGVCLIGLKREDDKSILLNPGPRHILAATDTCFYIN
ITKEENSAFIFKQEEKQQQRASPGQGLYQGPSRLPVQSIIASMGTVAMDLPSAECRPSQS
GGGGGGSKLALPTENGSGSRRPSIAPVLELADSSALLPCDLLSDQSEDEVTPSDDEGLST
VEYVRGYPPNSPYIGSSPTLCHLLPVKAPFCCLRLDKGCKHNSYEDAKAYGFKNKLIIVS
AETAGNGLYNFIVPLRAYYRSRKELNPIVLLLDNKPDHHFLEAICFFPMVYYMEGSVDNL
DSLLQCGVIYADNLVVVDKESTMSAEEDYMADAKTIVNVQTMFRLFPSLSITTELTHPSN
MRFMQFRAKDSYSLALSKLEKRERENGSNLAFMFRLPFAAGRVFSISMLDTLLYQSFVKD
YMISITRLLLGLDTTPGSGHLCAMKVTEEDLWIRTYGRLFQKLCSSSAEIPIGIYRTESH
VFSTSEPQDPRAQSQISVNVEDFEDTQDVRGPWSAPTGSGRGSTHGQQEGSEDPAEHPLL
RRKSLQWARRLSRRGTRHAGRAAAPEWTGQRRLSLCRRSERQELSELVKNRMKHLGLPTT
GYDEMNDHQNTLSYVLINPPPDTRLEPNDIVYLIRSDPLAHVVSGSQSWKASCSYKLSSC
DPETRDETQL
Download sequence
Identical sequences H0WYR9
ENSOGAP00000007682 ENSOGAP00000007682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]