SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007731 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007731
Domain Number 1 Region: 477-767
Classification Level Classification E-value
Superfamily Folate-binding domain 4.08e-84
Family Aminomethyltransferase folate-binding domain 0.0000322
Further Details:      
 
Domain Number 2 Region: 52-265,376-440
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.37e-57
Family FAD-linked reductases, N-terminal domain 0.00043
Further Details:      
 
Domain Number 3 Region: 265-375
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.77e-28
Family L-aminoacid/polyamine oxidase 0.0077
Further Details:      
 
Domain Number 4 Region: 769-854
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 4.41e-22
Family Aminomethyltransferase beta-barrel domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007731   Gene: ENSOGAG00000008622   Transcript: ENSOGAT00000008629
Sequence length 876
Comment pep:known_by_projection scaffold:OtoGar3:GL873536.1:13075518:13141388:-1 gene:ENSOGAG00000008622 transcript:ENSOGAT00000008629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRPAAQRLRGLALRSCPLRGSPGRPRSVCGREGDEKSLLPAEAKWKDRAETVIIGGGCI
GVSLAYHLAKAGMKDVVLLEKSELTAGSTWHAAGLTTYFHPGINLKKIHYDSIKLYEKLE
EETGQVVGFHQPGSIRLATTPVRVDEFKYQMTRTGWHATEQYIIEPEKIQEMFPLLNMNK
VLAGLYNPGDGHIDPYSLTMALAVGARKYGALLKYPAPVTSLKLRSDGTWDVETPQGSLR
ANRIVNAAGFWAREVGKMVGLEHPLIPVQHQYVITSTIPEVKALKRELPVIRDLEGSYYL
RQERDGLLFGPYESQEKMKAQDSWVTSGVPPGFGKELFESDLDRIMEHVEIAMEMVPVLK
KADIINIVNGPITYSPDILPMVGPHQGVRNYWVAIGFGYGIIHAGGVGKYLSEWILHGEP
PFDLIELDPNRYGKWTTTQYTEVKARESYGFNNIVGYPKEERFAGRPTQRVSGLYKILES
KCSMGFHAGWEQPHWFYKPGQDTQYRPSFRRTNWFEPVGCEYKQVMQRVGVIDLSPFGKF
NIKGRDSIRLLDRLFANVIPKVGFTNISHMLTPKGRVYAELTVSHQSPGEFLLITGSGSE
LHDLRWIEEEAVNGGYDVEIKNITDELGVLGVAGPRARKVLQKLTSEDLSDDAFKFLQTK
SFKVSNIPVTAIRISYTGELGWELYHRQEDSAALYDVIMNAGQEEEIDNFGTYAMNALRL
EKAFRAWGSEMNCDTNPLEAGLESFVKLNKPADFIGKQALRQIKAKGLKRRLVFLTLATD
DVDPEGNESVWYNGKVVGNTTSGSYSYSIQKSLAFAYVPVELSEVGQQVEVELLGKTYPA
VITREPLVLTEPARNRLQKKGGKDKWFPGYSRNPRF
Download sequence
Identical sequences H0WYV8
ENSOGAP00000007731 ENSOGAP00000007731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]