SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007739 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007739
Domain Number 1 Region: 530-562,637-666
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000012
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007739   Gene: ENSOGAG00000008630   Transcript: ENSOGAT00000008638
Sequence length 747
Comment pep:known_by_projection scaffold:OtoGar3:GL873524.1:5188616:5228645:1 gene:ENSOGAG00000008630 transcript:ENSOGAT00000008638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHAEENEILAATQRYYVERPIFSHPVLQERLHTKDKVPDSIGDKLKQAFTCTPKKIRNI
IYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPV
IMYCFFGTSRHISIGPFAVISLMIGGVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAM
SVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGI
FSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMG
TGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKT
LANKHGYQVDGNQEKELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLAS
LMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVS
SLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDTYEEVKEIPGIKIF
QINAPIYYANSDLYSNALKRKTGVNPALIMGARRKAMRKYAKEVGNANVANATVVKVDAE
VDGEDGTKPEEEDGEVKYPPIVVKSTLPEELQRFMPPGDNIHTIILDFTQVNFVDSVGVK
TVAGILVKTADIYTYIYVFYIYIAQVVNDLTRNRFFENPALWELLFHSIHDAVLGSQLRE
ALAEQEASALPLQDDLEPNATPATPEA
Download sequence
Identical sequences H0WYW6
ENSOGAP00000007739 ENSOGAP00000007739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]