SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007799 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007799
Domain Number 1 Region: 159-265
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-33
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 2 Region: 53-145
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.24e-18
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007799   Gene: ENSOGAG00000008700   Transcript: ENSOGAT00000008704
Sequence length 607
Comment pep:known_by_projection scaffold:OtoGar3:GL873594.1:9469849:9481315:1 gene:ENSOGAG00000008700 transcript:ENSOGAT00000008704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVVRWLMPLTLLTASCLTEVKSTEDEGKPNCTASLGGANLAEDHKALILQLNPSENCTW
TVERPENKSIRIIFSHIQLDPDGSCESENIEVFDGPSTTGTLLGKVCSENDFVPVFESSL
NTLTFQIVTDSAIIKRSVFIFYYFFSPGISIPNCGGYLDALEGSFTSPNYPKPHPELAYC
VWHIQVEKGYKIKLNFKEIFLEIDDQCRFDFVAVYDGSSTSSGLIGKVCGRVTPTFESSS
DSLTVVLSTDYANSYRGFSASYTSIYAENINTTSLTCSSDKMRVIISNSYLESYNYNGND
LQLNDPTCRPKVSNVVEFSIPLDGCGTIKKVEDQSITYTNIITFFASPTSEVITRQKHLQ
IIVKCEMEHNSTVEMMYVTEDDVIQNQNALGKYNTTMALFESNSFEKALLESPYYVDLNQ
TLFVQVSLHTSDPNLVVFLDTCRASPTSDFASPTYDLIKSGCSRDETCKVYPLFGHYGRF
QFNSFKFLRSLSSVYLQCKVLICDSGDHQSRCNQGCVSRRKRDISSYKWKTDSIIGPIRL
KRDRSASGNSEFQPQTHTGETQRQPFNSLHLFSFLVLALNVVIVVTVTVRHFVNQRAGYK
YQKLQDH
Download sequence
Identical sequences H0WZ15
ENSOGAP00000007799 XP_003794134.1.62490 ENSOGAP00000007799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]