SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007873 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007873
Domain Number 1 Region: 4-210
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.26e-26
Family Proteasome subunits 0.00000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007873   Gene: ENSOGAG00000008778   Transcript: ENSOGAT00000008781
Sequence length 210
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:25180270:25189146:-1 gene:ENSOGAG00000008778 transcript:ENSOGAT00000008781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV
QTVQSLENFRSSWETKTGIQKDNQPLMELSLIFSSQLAVGRAQASYTEGGGFDPASTKLQ
PPSHIFATTIRGAEALSKDSEIGGACGSGKELGPLETVKRPDQDPEHLFETISQAMLNAV
DRDAVSGMGVIVHIIEKDKITTRTLKARMD
Download sequence
Identical sequences H0WZ77
ENSOGAP00000007873 ENSOGAP00000007873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]