SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007913 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007913
Domain Number 1 Region: 442-597
Classification Level Classification E-value
Superfamily Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain 4.84e-59
Family Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain 0.0000000887
Further Details:      
 
Domain Number 2 Region: 18-386
Classification Level Classification E-value
Superfamily RNI-like 7.46e-55
Family Rna1p (RanGAP1), N-terminal domain 0.00003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007913   Gene: ENSOGAG00000008823   Transcript: ENSOGAT00000008828
Sequence length 598
Comment pep:known_by_projection scaffold:OtoGar3:GL873526.1:7148596:7170018:1 gene:ENSOGAG00000008823 transcript:ENSOGAT00000008828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCRSPGEPTVVTNMASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIED
FDGLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRSEIPAALISLGEGL
ITAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLHELKLNNCGMGIGGGKILAAALI
ECYRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFGIIGTLEEVHMPQNGINHPGVTA
LAQAFAINPLLRVINLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADA
IRGGLPKLKELNLSFCEIKRDAALAVAEAMADKTELEKLDLNGNILGEEGCEQLQEVLDG
FNMAKVLASLSDDEDEDEEEADEEEEGDEEEEEEEEEEEEEEEEEEEEPQQRGQGEESTT
PSRKILDPNSGEPAPVLTSPPPADVSTFLAFPSPEKLLRLGPKSSTLIAQQTDTSDPEKV
VSAFLKVSSVFKDEATVRTAVQDAVDALMKKAFSSPSFNSNAFLTRLLVHMGLLKSEDKI
KAIANLYGPLMVLNHMVQQDYFPKALAPLLLAFMTKPNGALESCSFARHNLLQTLYKV
Download sequence
Identical sequences H0WZA5
ENSOGAP00000007913 ENSOGAP00000007913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]