SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007915 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007915
Domain Number 1 Region: 202-381
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.46e-35
Family APC10-like 0.0023
Further Details:      
 
Domain Number 2 Region: 1818-1878
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000353
Family ZZ domain 0.0079
Further Details:      
 
Domain Number 3 Region: 1776-1827
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000388
Family ZZ domain 0.02
Further Details:      
 
Domain Number 4 Region: 90-147
Classification Level Classification E-value
Superfamily EF-hand 0.0000143
Family Calmodulin-like 0.053
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000007915
Domain Number - Region: 1107-1192
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00249
Family Spermadhesin, CUB domain 0.0072
Further Details:      
 
Domain Number - Region: 2706-2795
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0314
Family Spermadhesin, CUB domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007915   Gene: ENSOGAG00000008822   Transcript: ENSOGAT00000008830
Sequence length 2961
Comment pep:known_by_projection scaffold:OtoGar3:GL873664.1:1760156:1906396:1 gene:ENSOGAG00000008822 transcript:ENSOGAT00000008830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNATSHSSEDEGAAAGGEGWGPNQDWAADSGTTPSPGLAAPALPPAAALLEPARLREAA
AALRPTPPCESLVSRHHGALLRWLEERLGRGEESVTLEQFRELLEARGAGCSGEQFEEAF
AQFDAEGDGAVDAENMLEALKNSSGANLQGELSHVIRQLQACSLVPGFIDIFSESKEGLG
VHSSMILRFLHRNRISSMVIPYPMLEHCNNMCSMRSSVLKESLDQLVQKEKESPGDLTRS
PEMDKLKSVAKCYAYIETSSNSADIDKMTNGETSSYWQSDGSARSHWIRLKMKPDVVLRH
LSIAVAATDQSYMPQQVTVAVGRNASDLQEVRDVHIPSNVTGYVTLLENASISQLYVQIN
IKRCLSDGCDTRIHGLRAVGFQRVKKAGVSVSDASAIWYWSLLTSLVTASMETNPAFVQT
VLHNTQKALQHMPPLSLSPGSTDFSTFLSPNVLEEVDSFLIRITSCCSTPEVELTLLAFA
LARGSVAKVMSSLCTITDHLDTQYEASALISSMASVRQNLLLKYGKPLQLTLQACDVKGK
EDKSGPENLLVEPWTRDGFLTETGKTRASTIFSTGTESAFQVTQIRIMVRRGGIGAQCGL
VFAYNSSSDKFHAEEHFKRFEKYDKWKLQEFRQFVKSRIGCSSDDLGEDDPIGWFELEEE
WDEADVKLQQCRVAKYLMVKFLCTRQESAERLGVQGLSISGYLRPARADAEQSAICVHCR
KDSEESVCGATLLLKTLQFIQQLAHDLVQQKESGLKYKSFLDFAGLDLQIFWNFYSKLKQ
NQREECICAQTLLLQLLQSCFSVLQEEVAAASEGEKAPTPSPRGAAAAKELYTHLCDVVD
RVDGDSVTMEILKQEVRNTLLSGAAIFFPDRQTRRNHLFTMMNVTEQEHKQSLQLTFRSL
CTYFSDKDPSGLLLLPEKNDLAGMNISEVLAVMSTLLSVAARECELLMLNGAQGEAGSVL
FSLFWSVQGSLLSWCYLQLKGTDCGAKDLAVDLIEKYVRQFLASTKVILDSLLSQYSGKT
IVETLCNSVFSMAARQLVIFLLDFCTLDISHCTLLREFSAITELLKKLCSDCDGGLNKLD
VETWQQEQPVVLHTWTKESTHNYENNCHEVSVFVSPGATYFEVEFDERCETEKRYDYLEF
TDARGGKTRYDTKVGTDKWPKKVTFKAGPRLQFLFHSDSSNNEWGYKFTVTAYGLPDVAV
SWGLDLQLLVSRLMGRLASQCMALKSVHQLGSNKAVPQAKLALVLNSPLWKPVFRHQICP
ELELEASWPTHPHQDSKEVKNIPDDPCCHFLLDFAQSQAAQNFCGPYSELFKGFIQACRK
QAPKTDIVAGSTIDQAVNATFAALVYRTPDLYEKLQKYVNSGGKMALSEEFAQVYSLADG
IRIWMLEMKQKSLMSLGNETEEKHGSEAAETNPESLAKECIQKSLLLLKFLPMGISSKES
CDQLVTTDETDHLQLLDKRQRTSSMVEEHFQASASPTEVAPSPGHQSPGLDVHPKLLPSS
GPSAAEGSSAMVEEPLSPSTPTRRPPFTRGRLRLLSFRSMEEARPVPTVKEKYLVLKDIM
DFIKDQSLSSESVVKVLALKKAQAQSILEVLRIIQYCAESLGQPHCFHPPFILFLLELLT
CQKDFTNYFGHLEGCGADLHKEIRNAYYQLVLFLVKAIKGFGSINDRSLLPALSCVQTAL
LHLLDMGWEPGDLAFFVDIQLPELLMKMSQENISVHDSVISQWSEEDELADAKQNSEWME
ECQDGMFEAWYEKIAQEDPEKQRKMHMFIARYCDLLNVDISCDGCDEIAPSHRYRCLQCN
DMDLCKTCFLGGVKPEGHGDDHEMVNMEFTCDHCQGLIIGRRIHCNVCYDFDLCFGCYAA
KKFSCGHLPTHSIRAHPMVTIRISDRQKLIQPYIHNYSWLLFAALALYSAHLASAEDVDG
EKLDPQVRDSATTLRSRCMQLVGDCLMKAHQGKGLKALALLGVLPDGEPTPANEDLPVTV
PTQTSEEQLQKKAVHDAGALSEAGPGKEAVHEEVRPSDHKQRNKTDEAMSLMKDPSCQTQ
ISGSPTDASSQTGLPGAEDSEVSSRNPTEEKAVTSSPEQVFAECSQKRILGLLAAMLPPL
KLGPIVPLIDLEHVLPLMFQVVISNAGHLNETYHLTLGLLGQLILRLLPAEVDGAVIKIL
SAKHNLFAAGDSSIVPDGWKTTHLLFSLGAVCLDSRVGLDWACSMAEILRSLNSSPLWRD
VIATFTDHCIKQLPFQLKHTNIFTLLVLVGFPQVLCVGTRCVYMDNANEPHNVIILKHFT
EKNRAVIVDVKSRKRKTVKDYQLVQKGGGQEYGDSQAQLSQYSQHFAFIASHLLQTSMDS
HCPEAVEATWVLSLALKGLYKTLKAHSFEETHATFLQTDLLKLLVKKCSKGTGFSKTWLL
RDLEILSIMLYSSKKEINTWAEHRDLKLDEQGDSGEEVDRPVSSPDNLERKKLDPLEGLD
EPTRICFLMAHDALNAPLHILRAIFELQMKRTDSFFLEVQKRFDGDELTTDERIRSLAQR
WQPSKSLKVEEQIAKAVDTDMIILPCLSRPAHCEQATAEANPVTQKLISSTESELQQSYA
KQRRSKSAALLHKELNCKSKRAIRDYLFRVNEATSVLYARHVLAALLAEWPGRVPVSEDI
LELSGPAHMTYILDMFMQLEEKHQWEKILQKVLQGCRENMLGTMALAACQFMEESGMEVQ
VRESKHPYNNNTNFEDKVHIPGAIYLSIKFDSQCNTEEGCDELAMSSSSDFQQDRHNFSG
SQQKWKDFELPGDTLYYRFTSDMSNTEWGYKFTVTAGHLGRFQTGFEILKQMLSEERVVP
HLPLAKIWEWLVGVACRQTGHQRLKAIHLLLRIVPCCTHSDLCDLALLKPLWQLFTHMEY
GLFEDMTQPGILLPLHRALTELFFVTENRAQELGMLQDYLLALTTDDHLLRCAAQALQNI
AAISVAINYPNKATSLWNVQC
Download sequence
Identical sequences H0WZA7
ENSOGAP00000007915 ENSOGAP00000007915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]