SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007925 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007925
Domain Number 1 Region: 4-555
Classification Level Classification E-value
Superfamily SIS domain 1.72e-218
Family Phosphoglucose isomerase, PGI 0.00000000000000566
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007925   Gene: ENSOGAG00000008835   Transcript: ENSOGAT00000008842
Sequence length 559
Comment pep:known_by_projection scaffold:OtoGar3:GL873619.1:4611268:4649378:1 gene:ENSOGAG00000008835 transcript:ENSOGAT00000008842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALTRDPQFQKLQQWYREHGSDLNLRTLFEANKNRFSHFSLTLNTNHGHILVDYSKNLV
TEEVMKMLVDLAKSRGVEVARERMFNGEKINYTEDRAVLHVALRNQSNTPILVDGKDVMP
EVNRVLEKMKTFCQRVRSGEWKGYTGKAITDVINIGIGGSDLGPLMVTEALKPYSSDGPR
VWFVSNIDGTHIAKTLANLSPDSSLFIIASKTANTSRAEENGLCSASDWSLGSGEGGPST
VAKHFVALSTNTNKVKEFGIDPANMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFQQLLS
GAHWMDQHFRKTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDME
SNGKYITKSGVRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLVPVQSQHPIRK
GLHHKILLSNFLAQTEALMKGKSTDEARKELQAAGNNPEVLEKLLPHKVFEGNRPTNSIM
FTKLTPFILGALIAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGNTPVTSH
DSSTNGLINFIKREREPIA
Download sequence
Identical sequences H0WZB6
ENSOGAP00000007925 ENSOGAP00000007925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]