SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007978 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007978
Domain Number 1 Region: 395-585
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.14e-50
Family cAMP-binding domain 0.0000000145
Further Details:      
 
Domain Number 2 Region: 130-398
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.03e-35
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007978   Gene: ENSOGAG00000008900   Transcript: ENSOGAT00000008903
Sequence length 879
Comment pep:known_by_projection scaffold:OtoGar3:GL873524.1:46575722:46952264:1 gene:ENSOGAG00000008900 transcript:ENSOGAT00000008903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGGGKPNSSSNSRDDGNSVFSAKAPAASAGPAGAEKRLGTPPGGGGAGAKEHGNSVCFK
VDGGGGGAEESAGGFEDAEGPRRQYGFMQRQFTSMLQPGVNKFSLRMFGSQKAVEKEQER
VKTAGFWIIHPYSDFRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIVFNVASDTVF
LLDLIMNFRTGTVNEDSSEIILDPKVIKMNYLKSWFVVDFISSIPVDYIFLIVEKGMDSE
VYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMML
LLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALFKAMSHMLCIGYGAQAP
VSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPAD
MRQKIHDYYEHRYQGKIFDEENILNELNDPLREXXXNFNCRKLVATMPLFANADPNFVTA
MLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSKEMKLTDGSYFGEICLLTK
GRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLQKFQ
KDLNTGVFNNQENEILKQIVKHDREMVQAIAPINYPQMTALNSTASTTTPTSRVRTQSPP
VYTAPSLSHGNLHSPSPSTQTPQPSAILSPCSYTTAVCSPPVQSPLASRTFHYASPTASQ
LSLMQQQLQSQPPPQTQQPPPPPPQTPGSSTPKNEVHKSTQALHNASLTREVRPLSASQP
SLPHEVSTLISRPHPTVGESLASIPQPVTAVPGPGLQAAGRSSVPQRVTLFRQMSSGAIP
PNRGVPPAPPPPAAALQREASSVLNTDPEAEKPRFASNL
Download sequence
Identical sequences H0WZG0
ENSOGAP00000007978 XP_003782834.1.62490 ENSOGAP00000007978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]