SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007991 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007991
Domain Number 1 Region: 90-170
Classification Level Classification E-value
Superfamily F-box domain 1.44e-17
Family F-box domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007991   Gene: ENSOGAG00000008912   Transcript: ENSOGAT00000008916
Sequence length 187
Comment pep:known_by_projection scaffold:OtoGar3:GL873532.1:3536097:3624981:-1 gene:ENSOGAG00000008912 transcript:ENSOGAT00000008916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASWLPETLFEIVGQGPAPSKDYYQILVKRSQVIFRWWKISLRSEHRSAQPGEVKETHED
FLENSHLQVQIALIFGERVLDYIFNLCEGKFDFLERLSDNLLLSIISYLDLEDIARLSQT
SRRFAKLCMCEKLWEQIVKSSCDTITPDMQALAEDMGWRKMFFTNKLQLQQQLCKGKQNH
GNHIEKE
Download sequence
Identical sequences H0WZH2
ENSOGAP00000007991 ENSOGAP00000007991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]