SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008090 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008090
Domain Number 1 Region: 56-141
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000000000755
Family Snake venom toxins 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008090   Gene: ENSOGAG00000009022   Transcript: ENSOGAT00000009026
Sequence length 182
Comment pep:known_by_projection scaffold:OtoGar3:GL873583.1:8381794:8390151:1 gene:ENSOGAG00000009022 transcript:ENSOGAT00000009026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYVCLNRPQRRIRMLLPCHALAVAAIQIFVFSENWAFAKNINFYNVRPPLDPTPFPNSFK
CFTCENAGDNYDCNRWAEDKWCPQNTQYCLTVHHFTSHGRSTSITKKCASRSECHFVGCH
HSRDSEQTECRSCCEGMICNVELPTNHTNAVFAVMHAQRTSGSSVPVPCVPVLIWVFVLP
FL
Download sequence
Identical sequences H0WZQ8
ENSOGAP00000008090 ENSOGAP00000008090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]