SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008104 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008104
Domain Number 1 Region: 264-378,498-644
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.3e-65
Family Phosphate binding protein-like 0.00000000125
Further Details:      
 
Domain Number 2 Region: 10-252
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.85e-37
Family L-arabinose binding protein-like 0.017
Further Details:      
 
Domain Number 3 Region: 395-497
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000131
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008104   Gene: ENSOGAG00000009037   Transcript: ENSOGAT00000009040
Sequence length 733
Comment pep:known_by_projection scaffold:OtoGar3:GL873719.1:1953544:2064396:1 gene:ENSOGAG00000009037 transcript:ENSOGAT00000009040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NIFLVTFLPPTGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFVI
DCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPM
VTKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRNLRRQKIDISRRGNAGDC
LANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWN
DMDKLVLIQDVPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLA
SEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVI
DFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPY
EWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFT
LIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEK
MWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDS
KGYGVATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSL
SNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKVAKSAQTFNPTSSQNTQNLATYR
EGYNVYGTESIKI
Download sequence
Identical sequences H0WZR7
ENSOGAP00000008104 ENSOGAP00000008104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]