SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008182 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008182
Domain Number 1 Region: 164-384
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-53
Family DBL homology domain (DH-domain) 0.0000937
Further Details:      
 
Domain Number 2 Region: 375-512
Classification Level Classification E-value
Superfamily PH domain-like 1.52e-19
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 3 Region: 510-584
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-16
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008182   Gene: ENSOGAG00000009126   Transcript: ENSOGAT00000009130
Sequence length 620
Comment pep:known_by_projection scaffold:OtoGar3:GL873532.1:784214:822007:1 gene:ENSOGAG00000009126 transcript:ENSOGAT00000009130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELLAAAFSAACAVDHDSSTSESDTRDSAAGHLPGSQSSSTLGNGATPDECPALADSPTT
LTEALQMIHPIPADSWRNLIEQIGLLYQEYRDKSTLQEIETRRQQDAELQGHVEGSPAIE
DTPEEEEEEEEEEEEELASPPERKVLPQICLLSNPHSRFNLWQDLPEIRSSGVLEILQPE
EIRLQEAMFELVTSEASYYKSLNLLVSHFMENERLRKTLHPSEAHILFSNVLDVLAVSER
FLLELEHRMEENIVISDVCDIVYHYAANHFSVYITYVSNQTYQERTYKQLLQEKAAFREL
IAQLELDPKCKGLPFSSFLILPFQRITRLKLLVQNILKRVEERSERECTALDAHRELEMV
VKACNEGVRKMSRTEQMISIQKKMEFKIKSVPIISHSRWLLKQGELQQMSGPKTSRTLRT
KKLFHEIYLFLFNDLLVICRQIPGDKYQVFDSAPRGLLRVEELEDQGQTLANVFILRLLE
NADDREATYMLKASSQSEMKRWMTSLAPNRRTKFVSFTSRLLDCPQVQCVHPYVAQQPDE
LTLDLADILNILDKTEDGWIFGERLHDQERGWFPSSMTEEILNPKIRSQNLKECFRVHKM
DDPQRSQNKDRRKLGSRNRQ
Download sequence
Identical sequences H0WZX8
ENSOGAP00000008182 XP_003784899.1.62490 ENSOGAP00000008182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]