SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008185 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008185
Domain Number 1 Region: 322-604
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.3e-93
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000117
Further Details:      
 
Domain Number 2 Region: 145-321
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 7.06e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000885
Further Details:      
 
Domain Number 3 Region: 606-713
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.5e-28
Family Anticodon-binding domain of Class II aaRS 0.0014
Further Details:      
 
Domain Number 4 Region: 83-143
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000000305
Family TGS domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008185   Gene: ENSOGAG00000009129   Transcript: ENSOGAT00000009133
Sequence length 723
Comment pep:known_by_projection scaffold:OtoGar3:GL873582.1:2483961:2513483:1 gene:ENSOGAG00000009129 transcript:ENSOGAT00000009133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEKASSPPGKMGGEDKRVSTGEEKRKEGGKKKSKEGSGDGGRAELNPWPEYIYTRLEM
YNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYHIACGISQGLADNTVIA
KVNKVVWDLDRPLEEDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIE
NGFYYDMYLEEGGVSSNDFSSLEALCKKIIKEKQAFERLEVKKETLLQMFKYNKFKCRIL
NEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKTLKIHKNSSTYWEGKADMETLQRIYGI
SFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNTLIEFI
RSEYRKRGFQEVVTPNIYNSRLWMTSGHWQHYSENMFSFEVEKELFALKPMNCPGHCLMF
DHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCL
DFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWNQAEKQLENSLNEFGEKWELNPGDGAFY
GPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVSHDGDDKKRPVIVHRAILGSVERM
IAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNK
KIRNAQLAQYNFILVVGEKEKNSGTVNIRTRDNKVHGERTISETIERLQQLKQSRSKQAE
EEF
Download sequence
Identical sequences H0WZY1
ENSOGAP00000008185 XP_012662552.1.62490 ENSOGAP00000008185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]