SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008283 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008283
Domain Number 1 Region: 1043-1191,1226-1303
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.9e-35
Family Voltage-gated potassium channels 0.014
Further Details:      
 
Domain Number 2 Region: 1352-1594
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-34
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 3 Region: 577-812
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.04e-26
Family Voltage-gated potassium channels 0.018
Further Details:      
 
Domain Number 4 Region: 128-278,338-407
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.82e-26
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008283   Gene: ENSOGAG00000009240   Transcript: ENSOGAT00000009254
Sequence length 1770
Comment pep:known_by_projection scaffold:OtoGar3:GL873601.1:717211:821311:-1 gene:ENSOGAG00000009240 transcript:ENSOGAT00000009254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDRCYPVIFPDARNFRPFTSDSLAAIEKRITIQKEKKKAKEKTGDEPPPRPQLDLRASR
KLPKLYGDIPCELIAKPLEDLDPFYRNHKTFMVLNKKRTIYRFSAKRALFIFGPFNSIRS
FAIRISVHSIFNMFIICTVIINCVFMARCGSKDNNSTETHSAEFVFTGIYIFEALIKILA
RGFILDEFSFLRDPWNWLDSIVIGTAIVSYFPSIRINLSSLRSFRVLRALKAISVVSGLK
VIVGALLRSVKKLVNVMILTLFCLSIFALIAQQLFMGGLNQKCIKKDCDRDNSKANESCF
EKKENSTEFKMCGTWMGSRNACSEQFECSHTDYNPDYNYTNFDHFGWSFLAMFRLITQDS
WEKLYQQTLRTCGLYSVFFFVVVIFLGSFYLINLTLAVVTMSYEEQNRNVAAETEAKEKM
FQEAQQLLKEEKEALVAMGIDRSSLNSLEASLFSPQKRKIFGYKKRKSFFLRESGKNQPL
GSDSDEDCSKKPHVLEQTKRLSQNLSLDHFDEHGDPLQRQRALSAVSILTITMREQEKSQ
EPCLPCGKNLASEYLVWECSPQWLCIKKVLRTVMTDPFTELAITICIIINTVFLAMEHDN
MDNSFENILNTGNMVFTGIFIAEMCLKIIALDPYHYFRRGWNIFDSIVAVLSFADVMTNK
SSKPRWQFLRSFRVLRIFKLAKSWPTLNTLIKIIAHSVGALGNLTVVLAIVIFIFSVVGM
QLFGSTFKSAKTEEPCDTTNPCPRRWHMGDFYHSFLVVFRILCGEWIENMWECMQANGIP
LCIIVFVSIMVIGKLVVLNLFIALLLNSFSNEERDGNLEGEAKKTKVHLALLRFHKAFCF
VIHTFAHFYRRWCRRQNSPKQKEMRRGPATESKDVIPLVTEMKKISETQEFGILTSAPRT
LGTGHDRTWLAPLAEEEVDIESPDGENAQPITQPKAERQAYELHQENKKSASPGVQSVEI
DIFPEFEQNPPKKSDATSMLSECSTIDLQWQFQLPEVVPKREPERCLPKGLGCSFPCCGM
DKTKSPCITWWNLRKTCYQIVKHSWFESFIIFVILLSSGTLVFEDVYLKERPQIEALLNC
TDKIFTHIFILEMGLKWVAFGFTKYFTSAWCWLDFIIVIVSVPSLIDLKGLRSFRTLRAL
RPLRALSQFEGMKVVVNALIGAIPAILNVLLVCLIFWLIFCILGVNFFSGKFGRCLNVTN
AIDISIIADKNQCVSHNYSWHNLEVNFDNVGNAYLALLQVATFKGWMDIMYAAVDSGERE
QQPVFENNSLMYLYFVVFIIFGSFFTLNLFIGVIIDNFNQQQKKLGGQDIFMTEEQKKYY
NAMKKLGSKKPQKPIPRPLNKCQGLVFDLVTSQVFDIVIISLIILNMVIMMAESYNLTED
TKTILDNLNRAFVVIFTIECLIKIFALRQYYFINGWNLFDCVVVVLSIVSTIVSELEQKL
INFPPTLFRIVRLARIGRILRLVRAARGIRTLLFALMMSLPSLFNIGLLLFLVMFIYAIL
GMNYFSKVKPESGIDDIFNFRTFGSSMLCLFQITTSAGWDALLKPMLSEKSCNSSSENCR
HLRAIATTYFVSYIIISFLIVVNMYIAVILENFNTATEESEEPLGEDDFEIFYEVWEKFD
PEATQFIKYSALSDFADSLPEPLRVAKPNKFQFLVMDLPMVSGDRLHCMDVLFAFTTRVL
GDSDGLDSMKTMMEEKFMEANPSKQLYEPIVTTTKRKEEERGAVIIQKAFRKYWKTAKGD
LENRPHLPLQTLCNGDLSSSGVAQGKVHCD
Download sequence
Identical sequences H0X063
ENSOGAP00000008283 ENSOGAP00000008283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]