SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008309 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008309
Domain Number 1 Region: 140-211
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000058
Family Snake venom toxins 0.03
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000008309
Domain Number - Region: 49-116
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00855
Family Snake venom toxins 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008309   Gene: ENSOGAG00000009279   Transcript: ENSOGAT00000009281
Sequence length 251
Comment pep:known_by_projection scaffold:OtoGar3:GL873671.1:888996:891561:1 gene:ENSOGAG00000009279 transcript:ENSOGAT00000009281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRHTQGLLLLFLLGASSSTEAPEVQCFKNVSMYIEEKDYHAFTWTTENVETCDNVTFC
QESILIIKAAGTKTAILATKGCIPATMEEIMYIQHTPPPGLVAVSYSSYCDKSVCNDKDR
LNEFGNLQEIPVTPTVSPTLQCPTCVALGTCDSAPSLPCPQGATRCYEGRLEIAGGGIES
SVEVKGCTALMGCRLMAGMLTVGPMLVKEICQNKPLTQTPKAESGATCLPILVWRLHLLL
PLVLESLVHFS
Download sequence
Identical sequences H0X084
ENSOGAP00000008309 ENSOGAP00000008309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]