SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008323 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008323
Domain Number 1 Region: 329-605
Classification Level Classification E-value
Superfamily RNI-like 2.55e-36
Family Cyclin A/CDK2-associated p19, Skp2 0.006
Further Details:      
 
Domain Number 2 Region: 265-335
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000379
Family F-box domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008323   Gene: ENSOGAG00000009292   Transcript: ENSOGAT00000009296
Sequence length 622
Comment pep:known_by_projection scaffold:OtoGar3:GL873651.1:2351458:2407773:1 gene:ENSOGAG00000009292 transcript:ENSOGAT00000009296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPVFPMLTVLTMFYYMCLRRRARTATRGEMMNNHRTIESNSRTCPLNAEVVQYAKEVVD
FSSHYGSENSMSYTMWNLAGVPNVFPSSGDFTQTAVFRTYGMWWDQCPSASLPFKRTPPN
FQSQDYVELTFEQQVYPTAVHVLETYHPGAVIRILACSANPYSPSPTAEVSRWEILWSER
PTKVNASQARQFKPCIKQINFPTNLIRLEVNSSLLDYYTELDAVVLHGTKDKPELSLKTS
LIDMNGLEEDAYEKKDGCRMDNLNKKFISAILREGPNNGYFDQLPYELIQMILNHLTLPD
LCRLAQTCKLLNQHCCDPLQYIHLNLQPYWAKLNDASLGFLQARCTLVQWLNLSWTGSRG
FISVMGFSRFLKVCGSELVRLELSCSHFLNETCLEVISEMCPSLQDLNLSSCDKLPPQAF
NHIAKLCSLKRLVLYRTKVEQTALLSILNFCSELQHLSLGSCVMIEDYDVIASMIGAKCK
KLRTLDLWRCRNITENGIAELASGCPLLEELDLGWCPTLQSSAGCFTRLARQLPNLQKLF
LTANRSVCDIDIEELACHCTRLQQLDILGTRMVSPASLRKLLESCKDLSLLDVSFCSQID
NRAVLELNASFPKVFIKKSFTH
Download sequence
Identical sequences H0X095
ENSOGAP00000008323 ENSOGAP00000008323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]