SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008348 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008348
Domain Number 1 Region: 67-112
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000327
Family HLH, helix-loop-helix DNA-binding domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008348   Gene: ENSOGAG00000009322   Transcript: ENSOGAT00000009322
Sequence length 154
Comment pep:known_by_projection scaffold:OtoGar3:GL873770.1:92314:93060:-1 gene:ENSOGAG00000009322 transcript:ENSOGAT00000009322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVASGSATAAAGPSCALKAGKTAGGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQ
VNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPAGR
GLPVRAPLSTLNGEISALAAEAACVPADDRILCR
Download sequence
Identical sequences H0X0B5
ENSOGAP00000008348 ENSOGAP00000008348 XP_003802655.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]