SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008370 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008370
Domain Number 1 Region: 216-455
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.05e-48
Family Voltage-gated potassium channels 0.0016
Further Details:      
 
Domain Number 2 Region: 61-174
Classification Level Classification E-value
Superfamily POZ domain 1.41e-26
Family Tetramerization domain of potassium channels 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008370   Gene: ENSOGAG00000009347   Transcript: ENSOGAT00000009348
Sequence length 516
Comment pep:known_by_projection scaffold:OtoGar3:GL873566.1:1104499:1116843:1 gene:ENSOGAG00000009347 transcript:ENSOGAT00000009348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTPSRERGLRPGHHHYDSYTPLSQLLPGPVETPTIKGLYYRRVRKVGALDASPAADLRK
EILVNVGGRRYRLPWSTLDEFPLSRLSKLRLCRSSEEITQLCDDYDEDNQEFFFDRSPSA
FGVIVSFLAAGKLVLLQEMCALSFREELTYWGIEETNLEKCCLRRLLGRLEELAELRRAE
ALQPPGEACSPAAQASRWGLCMHRLREMVENPQSGLPGKVFACLSILFVATTAISLCVST
MPDLRAEEDKGECSQKCYYIFIVETVCVAWFSLEFCLRFVQAQNKCQFFQGPLNIIDILA
ISPYYVSLVVSEPPEDGERPSGSSYLEKVGLVLRVLRALRILYVMRLARHSLGLQTLGLT
VRRCAREFGLLLLFLGVAVTLFSPLVYVAENESGRVLEFTSIPASYWWAIISMTTVGYGD
MVPRSVPGQMVALSSILSGILIMAFPATSIFHTFSHSYLELKKEQEQLQARLRRLQNTTT
ASDGELLGATTASEHELMKDVDDLTLESPASPVLRI
Download sequence
Identical sequences H0X0D3
ENSOGAP00000008370 ENSOGAP00000008370 XP_003791342.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]