SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008389 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008389
Domain Number 1 Region: 72-200
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.8e-46
Family Regulator of G-protein signaling, RGS 0.00000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008389   Gene: ENSOGAG00000009366   Transcript: ENSOGAT00000009367
Sequence length 211
Comment pep:known_by_projection scaffold:OtoGar3:GL873535.1:2219438:2221966:-1 gene:ENSOGAG00000009366 transcript:ENSOGAT00000009367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSAMFLAVQHDCRPMDNNAGSGPKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKT
SKKNKQQTFIKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK
KTKSPQKLSSKAKKIYTDFIEKEAPKEINIDFQTKTLIAQNIQDATSGCFTTAQKRVYSL
MENNSYPRFLESEFYQDLCKKPQISTEAHAT
Download sequence
Identical sequences H0X0F1
XP_003785653.1.62490 ENSOGAP00000008389 ENSOGAP00000008389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]