SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008392 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008392
Domain Number 1 Region: 29-115
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 2.62e-20
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000008392
Domain Number - Region: 605-665
Classification Level Classification E-value
Superfamily F-box domain 0.0275
Family F-box domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008392   Gene: ENSOGAG00000009369   Transcript: ENSOGAT00000009372
Sequence length 807
Comment pep:known_by_projection scaffold:OtoGar3:GL873675.1:211296:227853:1 gene:ENSOGAG00000009369 transcript:ENSOGAT00000009372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGGRSCGPRTRREPSSGEEAAPVTAMAAESALQVVEKLQARLAANPDPKKLLKYLKKLS
TLPITVDILAETGVGKTVNSLRKHEHVGNFARDLVAQWKKLVPVERSTEPDEQDFEKNHS
RKRPRDVLQKEEEVEVDYQENWKASSSRSYSPSSEHRQKKHRKASELERPHKVSHSHERR
DERKRCHRVSPTYSSDHESSDYGHVQSPPSSASPHQMYTDHYRSPEEDHEPIVSPQKPGK
GHSSAFQDRLGVSQEQRHLGEPQGKGVMHQNKEHKSSHKEKRPTDAKGDEKSSALSREKS
HKALSKEENRRPPPGDSTKEKLPSGGVKKEKEREGSSLKKKFLPPLETASDNHLKKPKHK
DSEKTKSDKTKQSVDSLDVGKGAGELLPKVKEKVSNNLKTQEGKVKTSNLDRKSLGSLPK
GEDADMEDEFEQPTMSFESYLSYDQPRKKKKKIVKTATPALKEKGLKKSDSKSTSKNLDL
VQKLPKVNENKAEKLQPAGANSAKLKKVPDVLPVLPDLPLPAIQANYRPLPSLELISSFQ
PKRKAFSSPQEEEEAGFTGRRMNSKMQVYSGSKCAYLPKMMTLHQQCIRVLKNNIDSIFE
VGGVPYSVLEPVLERCTPDQLYRIEEYNHVLIEETDQLWKIHCHRDFKEERPEEYESWRE
MYLRLQDAREQRLRLLTKNIRSAHANKPKGRQAKMAFVNSVAKPPRDVRRRQEKFGTGGA
AVPDRVKIKPAPYPTGSSHAPASSGSGNSFNPSPEEPAYDGPSTSGAHLAPVVSSTVSYD
PRKPTVKKIAPMMAKTIKAFKNRFSRR
Download sequence
Identical sequences H0X0F4
XP_003799801.2.62490 ENSOGAP00000008392 ENSOGAP00000008392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]