SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008468 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008468
Domain Number 1 Region: 70-483
Classification Level Classification E-value
Superfamily RNI-like 1.61e-62
Family 28-residue LRR 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008468   Gene: ENSOGAG00000009457   Transcript: ENSOGAT00000009460
Sequence length 552
Comment pep:known_by_projection scaffold:OtoGar3:GL873603.1:7425209:7455690:-1 gene:ENSOGAG00000009457 transcript:ENSOGAT00000009460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQTRKKNSSEGETKSQISPVNRFLQGCKAERGEENNDLGSDGSHPNHGALSTATQDAAK
PPSSEEELESRMEESEQFLQKLDRKADSKRLDLDSCRVTRVDIREMVTLLPFLPDLEELD
VSWNDSIGGNLHLITQQVHLVHKLKTLRLGSCRLTTEDVQALGEVLAMTPELEELNLSWN
NNVGGNLPLIFQKLQNGTKVQTLELVDCALTSEDGAFVGQLLPVLQSLEVLDLSMNRQVG
CSLNRIALGLKCTSNLKVLKLQSCGLSPKSIKILDAAFRYLGELRKLDLSCNKKLGGGFE
GSSGQLALLKHLRGLDLHQCSLTAGDVAALTQLIPLLSSLQEVDLSANRNVGGASENLLA
RLRFLPALRSLLISGCALEGPALAALADASIHLPALEIFNLSWNKCVGGSVQLLLEMLRL
SAGLQVLRLSSCSLVTKDMAILVSVMQTGHLARLQTLDLSYNDSICDEGWAVFCRNMQFL
KELTELDISLRPTNFRDCGPWVRHLLCAVTKLPEITEISMERWILPASQRAALGSCDQGH
TRRVHFDHSGFQ
Download sequence
Identical sequences H0X0L7
ENSOGAP00000008468 XP_003794727.1.62490 ENSOGAP00000008468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]