SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008481 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000008481
Domain Number - Region: 30-81
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0447
Family Voltage-gated potassium channels 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008481   Gene: ENSOGAG00000009472   Transcript: ENSOGAT00000009476
Sequence length 250
Comment pep:known_by_projection scaffold:OtoGar3:GL873670.1:2548482:2555923:-1 gene:ENSOGAG00000009472 transcript:ENSOGAT00000009476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VARYNRTNYFYPTFSESSEHSHLLVSPVLVASAVIGVVIILSCITIIVGSIRRDRRARLQ
RHQHRHRHRHHHHHRRRHRHREYEHGYVSDGHTSSRSSHRMRYACSTTEDWPPPLDISSD
GEMDATVLRELYPDSPPGKRECMGPGATQLYVPTDAPPPYSLTDSCPTLGGTPDSGSGHS
LHEHQQEQRTPGQRGVRTVSMDTLPPYEAVCGAGPPSGLLPLPGPGPGPRGSQGSPAPTR
APASGPERIM
Download sequence
Identical sequences H0X0M9
ENSOGAP00000008481 ENSOGAP00000008481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]