SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008516 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008516
Domain Number 1 Region: 27-111
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000000243
Family Extracellular domain of cell surface receptors 0.049
Further Details:      
 
Domain Number 2 Region: 122-189
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000051
Family Extracellular domain of cell surface receptors 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008516   Gene: ENSOGAG00000009513   Transcript: ENSOGAT00000009518
Sequence length 212
Comment pep:known_by_projection scaffold:OtoGar3:GL873671.1:1028332:1031028:1 gene:ENSOGAG00000009513 transcript:ENSOGAT00000009518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSSTRPGTFLLAFMLLCALLGLGCPLSCEVCKGSGPTCSGKMKTCDAGKDACVVLVGES
STKGQQSVNTYKACIKFTDCYSGFVSTTMSPKDYMVSNAHCCQSDGCNRDSVPPPQNNRT
ENGLLCPACIAPFQETCPGTQAARCVGQETHCIYFAGNVQAGIFNTKFATRGCATESACY
TKVGAEVPSASYLYFLRRADCLPAPQPPGRAE
Download sequence
Identical sequences H0X0Q8
ENSOGAP00000008516 ENSOGAP00000008516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]