SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008522 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008522
Domain Number 1 Region: 261-510
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.37e-83
Family Eukaryotic proteases 0.00016
Further Details:      
 
Domain Number 2 Region: 165-266
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-19
Family Scavenger receptor cysteine-rich (SRCR) domain 0.068
Further Details:      
 
Domain Number 3 Region: 128-168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000668
Family LDL receptor-like module 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000008522
Domain Number - Region: 27-73
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0366
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008522   Gene: ENSOGAG00000009520   Transcript: ENSOGAT00000009525
Sequence length 513
Comment pep:known_by_projection scaffold:OtoGar3:GL873647.1:1366249:1390063:-1 gene:ENSOGAG00000009520 transcript:ENSOGAT00000009525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHLEHSKYLPLLDAVDKFRMALNSGSPPGAGPYYENQGYQPENLYSSQPAMAPNPYAVYP
AQYYPSTVPQYAPRVVTSASTPTVNVRPKSLGGTTCSSKTKKALYITAALGTILVGGVLA
IVLLWKFIENKCVDSQMECGSSGTCISPYHWCDGISHCPHGEDENRCVRLYGPNFILQVY
SSQRKSWHPVCEDDWSESYGRVACKDLGYKNSFYSSQGITDDTGASDFMKLNKSAGNIEL
YKKLYHSNTCSSKKVVSLRCIACGATWNTSSHSRIVGGSGANLGDWPWQVSLHVQNFHVC
GGSIITPEWIVTAAHCVEEPLNNPRHWTAFAGILRQSFMFYGSGNRVEKVIPHPNYDSKT
KNNDIALMKLRTPLTFNETDKVRPVCLPNLGLMLQPEQPCWISGWGSTKDKGKTSDVLNA
ALVYLIEPWKCNSKYVYNNLITPAMVCAGYLQGTVDSCQGDSGGPLVTLKNGVWWLVGDT
SWGSGCAKPNRPGVYGNVTVFADWIYRQMRVTF
Download sequence
Identical sequences H0X0R3
ENSOGAP00000008522 ENSOGAP00000008522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]