SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008566 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008566
Domain Number 1 Region: 191-517
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.83e-80
Family Protein kinases, catalytic subunit 0.00000181
Further Details:      
 
Domain Number 2 Region: 34-186
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.2e-30
Family Regulator of G-protein signaling, RGS 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008566   Gene: ENSOGAG00000009576   Transcript: ENSOGAT00000009579
Sequence length 553
Comment pep:known_by_projection scaffold:OtoGar3:GL873551.1:11425512:11457109:1 gene:ENSOGAG00000009576 transcript:ENSOGAT00000009579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDMGGLDNLIANTAYLQARKPSDGDSKELQRRRRSLALPGRQGCAELRRALSPHFHSLC
EQQPIGRRLFRDFLATVPTYREAVAFLEDVQSWELAEEGSAKDSALQGLVAACAPGPAPG
HPHPFLSPALATRCQAATTEDERAAVVALAKAEAMAFLQEQPFRDFLASPFYDKFLQWKL
FEMQPVSDKYFTEFRVLGKGGFGEVCAVQVKNTGKMYACKKLDKKRLKKKNGEKMALLEK
EILEKVNSPFIVSLAYAFENKSHLCLVMSLMNGGDLKFHIYSVGTRGLPMSRVVFYAAQM
ACGVLHLHTLGIIYRDLKPENVLLDDLGNCRLSDMGLAVQIQDGKPITQRAGTNGYMAPE
ILMEKVSYSYPVDWFAMGCSIYEMVAGRTPFKDYKEKISKEDLKQRTLKEEVRFQHDNFT
EEAKDICRLFLAKKPEQRLGSREKSDDPRKHPFFNTINFARLEAGLIEPPFVPDPSVVYA
KDIAEIEDFSEVRGVEFDDKDKKFFQRFATGAVPIAWQEEIIETGLFEELNDPNRPRGCG
EGTSSKSSVCLLL
Download sequence
Identical sequences H0X0U5
ENSOGAP00000008566 ENSOGAP00000008566 XP_003789496.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]