SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008583 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008583
Domain Number 1 Region: 354-545
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.49e-50
Family cAMP-binding domain 0.0000000278
Further Details:      
 
Domain Number 2 Region: 87-357
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.68e-37
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008583   Gene: ENSOGAG00000009594   Transcript: ENSOGAT00000009597
Sequence length 780
Comment pep:known_by_projection scaffold:OtoGar3:GL873610.1:4886422:4896368:-1 gene:ENSOGAG00000009594 transcript:ENSOGAT00000009597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAERQPAAGADGGETPGLEGLPPAAPAPKPAAAGRIPGVGPEPKRRQLGTLLQPTVNKF
SLRVFGSHKAVEIEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGITFFKE
ENSPPWIVFNVLSDTFFLLDLVLNFRTGIVVEEGAEILLAPRAIRMRYLRTWFLVDLISS
IPVDYIFLVVELEPRLDAEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHM
TYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPPDCWVSINHMVNHSWGRQYSH
ALFKAMSHMLCIGYGQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQY
QEKYKQVEQYMSFHKLPADTRQRIHEYYEHRYQGKMFDEESILGELSEPLREEIINFTCR
GLVAHMPLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSVLARGA
QDTRLTDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMMRRAFETVA
MDRLRRIGKKNSILQRKRSEPSPGSSGGLMEQHLVQHDRDMARGVRGLAPGTGARLSGKP
VLWEPLVHAPLQAAAVTSSVAIALTHQRGPLLLSPDSPAVLLTRSARCSAGSPASPLVPV
RAGPLLVRGPWASTSRLPAPPARTLHASLSRTGRSQVSLLGPPPGGGGRWLGPRGRPLSA
SQPSLPQRAAGDGSPGRKGSGSERLPPSGLLAKPPGTVQPPRPPVPEPAASRGPQLSANM
Download sequence
Identical sequences H0X0W1
XP_003795335.1.62490 ENSOGAP00000008583 ENSOGAP00000008583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]