SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008600 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008600
Domain Number 1 Region: 52-410
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.76e-69
Family L-arabinose binding protein-like 0.0023
Further Details:      
 
Domain Number 2 Region: 430-545,664-808
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.41e-64
Family Phosphate binding protein-like 0.0000000015
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000008600
Domain Number - Region: 515-660
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00161
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008600   Gene: ENSOGAG00000009612   Transcript: ENSOGAT00000009615
Sequence length 912
Comment pep:known_by_projection scaffold:OtoGar3:GL873765.1:275324:717197:1 gene:ENSOGAG00000009612 transcript:ENSOGAT00000009615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKRVFPAKYYWDFCKIIMLLVFLWFSVNLSSTHVKHLLGGIFEYVESGPMGAEELAFRFA
VNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQS
ICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDST
GLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILK
QALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMER
LQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNRHKPWRFGTRFM
SLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGK
PANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEI
RLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISI
LYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSD
VVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLT
VERMESPIDSADDLAKRDKIEEFLIYHKRKSGASHTFFQKSKISTYDKMWAFMSSRRQSV
LVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRD
KITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAAGLVLSVF
VAVGEFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTF
NDRRLPGKETMA
Download sequence
Identical sequences H0X0X5
ENSOGAP00000008600 ENSOGAP00000008600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]