SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008644 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008644
Domain Number 1 Region: 291-477,611-658
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 7.32e-38
Family Phospholipase D 0.068
Further Details:      
 
Domain Number 2 Region: 673-868
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.67e-27
Family Nuclease 0.048
Further Details:      
 
Domain Number 3 Region: 72-205
Classification Level Classification E-value
Superfamily PX domain 0.00000000000000353
Family PX domain 0.0096
Further Details:      
 
Domain Number 4 Region: 216-321
Classification Level Classification E-value
Superfamily PH domain-like 0.00000382
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008644   Gene: ENSOGAG00000009655   Transcript: ENSOGAT00000009666
Sequence length 1007
Comment pep:known_by_projection scaffold:OtoGar3:GL873565.1:13125908:13139605:1 gene:ENSOGAG00000009655 transcript:ENSOGAT00000009666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSLRFSHVPRMTASPENLFLSGDDLDSSQLQMGSDEVDTLREGEDPADRMHPFLAIYDIK
PLKVYPLVFAPGVPVTAQVVGTERYTSGSKVGTCTLYSVQLTHGDFTWTTKKKFRHFQEL
HRDLLRHKLLMSLLPLARFAVASSPAQEAGDREIPSLPRAAPEGSTRQAASKQKYLENYL
NHLLTMSFYRNYHAMTEFLEVSQLSFIPDLGSKGLEGVIRKRSGGHRVPGLTCCGRDQVC
YRWSKRWLVVKDSFLLYMCLETGTISFVQLFDPGFEVQVGKRRTETRYGVRIDTSHRSLI
LKCSSYRQARWWGQEITELAQGPGRDFLQLHQHGSYAPPRPGTLARWFVNGAGYFAAVAD
AILKAQEEIFITDWWLSPEVYLKRPAHSDDWRLDIMLKKKAEEGVRVSVLLFKEVELALG
INSGYSKRALMLLHPNIKVMRHPDQVTLWAHHEKLVVVDQIVAFLGGLDLAYGRWDDLQY
RLTDLGDSSESAASQVAPQRPSREFLTLSRTARTHLENTVTQHLPHSSEGIGCKCIQRGE
LGTKLSFSFSVSPSPSHSFSAPIFSLALAVWHLSHNQFFWLGKDYSNLITKDWVQLDRPF
EDFIDRETTPRMPWRDVGVIVHGLPARDLSRHFIQRWNFTKTTKAKYKTPMYPYLLPKST
STANLLPFTFPGGQCTTVQVLRSVDRWSAGTLENSILNAYLHTIRESQHFLYIENQFFIS
CSDGRTILNKVGDEIVDRILKAHKQGQCFRVYVLLPLLPGFEGDISTGGGNSIQAILHFT
YRTLCRGEYSILHRLKAAMGTAWRDYISICGLRTHGELGGHPVSELIYIHSKMLIADDRK
VIIGSANINDRSLLGKRDSELAVLIEDTEMEPSLMDGAEYQAGRFASSLRKHCFSVILGA
HARPDLDLRDPICDDFFQLWQETAERNANIYEQIFRCLPSNATRSLRTLREYVAVEPLAT
VSPPLARSELTHIQGHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT
Download sequence
Identical sequences H0X108
ENSOGAP00000008644 ENSOGAP00000008644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]