SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008648 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008648
Domain Number 1 Region: 16-363
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.07e-68
Family L-arabinose binding protein-like 0.001
Further Details:      
 
Domain Number 2 Region: 421-527,646-677
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.78e-34
Family Phosphate binding protein-like 0.000000688
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000008648
Domain Number - Region: 537-641
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000549
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008648   Gene: ENSOGAG00000009665   Transcript: ENSOGAT00000009671
Sequence length 677
Comment pep:known_by_projection scaffold:OtoGar3:GL873630.1:5852881:5971123:1 gene:ENSOGAG00000009665 transcript:ENSOGAT00000009671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGIFETVENEPVNVEELAFKFAVTSINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQ
LALGVAALFGPSHSSSVSAVQSICNALEVPHIQTRWKHPSVDNKDLFYINLYPDYTAISR
AILDLVLYYNWKTVTVVYEDSTGLIRLQELIKAPSRYNIKIKIRQLPSGNKDAKPLLKEM
KKGKEFYVIFDCSHETAAEILKQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTG
FRLLNIDNPHVSSIIEKWSMERLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRAS
QLTVSSLQCHRHKPWRLGPRFMNLIKEARWDGLTGRITFNKTNGLRKDFDLDIISLKEEG
TEKKTKAAGEVSKHLYKVWKKQVLGIKNSWIGKGPSDSFKKHKFNNLVLIFSHSTLLFSN
ISEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFIYDVKLVPDGKYGAQNDKGEW
NGMVKELIDHKADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNP
LSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGA
LMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQT
KIEYGAVRDGSTMTFFK
Download sequence
Identical sequences H0X112
ENSOGAP00000008648 ENSOGAP00000008648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]