SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008801 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008801
Domain Number 1 Region: 140-412
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.02e-23
Family WD40-repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 40-125
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000209
Family F-box domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008801   Gene: ENSOGAG00000009841   Transcript: ENSOGAT00000009843
Sequence length 460
Comment pep:known_by_projection scaffold:OtoGar3:GL873533.1:23657288:23677993:-1 gene:ENSOGAG00000009841 transcript:ENSOGAT00000009843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERKDFETWLDNISVTFLSLTDLQKNETLDHLISLSGAVQLRHLSNNLETLLKRDFLKLL
PLELSFYLLKWLDPQTLLTCCLVSKQWNKVISACTEVWQTACKNLGWQIDDSVQDALHWK
KVYLKAILRMKQLEDHEAFETSSLIGHSARVYALYYKDGLLCTGKRHELELVLCFLFLVC
LYFMGCKQKTVIFVKFYEKKSFTYSFKHNVNHWQXGLGIRTRHLRYHCQRLYALVFSVDY
NDELDILVSGSADFTVKVWALSAGTCLNTLTGHTEWVTKVVLQKCKVKSLLHSPGDFILL
SADKYEIKIWPIGREINCKCLKTLSVSEDRSICLQPRLHFDGKYIVCSSALGLYQWDFAS
YDILRVIKTPEIANLALLGFGDIFALLFDNRYLYIMDLRTESLISRWPLPEYRKSKRGSS
FLAGEASWLNGLDGHNDTGLVFATSMPDHSIHLVLWKEHG
Download sequence
Identical sequences H0X1D6
ENSOGAP00000008801 ENSOGAP00000008801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]