SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008802 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008802
Domain Number 1 Region: 145-336
Classification Level Classification E-value
Superfamily E set domains 2.43e-53
Family Cytoplasmic domain of inward rectifier potassium channel 0.00024
Further Details:      
 
Domain Number 2 Region: 36-186
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.3e-24
Family Voltage-gated potassium channels 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008802   Gene: ENSOGAG00000009842   Transcript: ENSOGAT00000009844
Sequence length 360
Comment pep:known_by_projection scaffold:OtoGar3:GL873532.1:918931:929054:1 gene:ENSOGAG00000009842 transcript:ENSOGAT00000009844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTNCKVIAPLLSQKYRRMVTKDGHSTLQMDGAQRGLAYLRDAWGILMDMRWRWMMLVF
SASFVVHWLVFAVLWYVLAEMNGDLELDHDAPPENHTICVKYITSFTAAFSFSLETQLTI
GYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDLAVVAH
IDGKPNLIFQVANTRPSPLTSVRISAVLYQERENGKLYQTSVDFHLDGISSEECPFFIFP
LTYYHSITPSSPLATLLQHENPSHFELVVFLSAMQEGTGEICQRRTSYLPSEIMLHHCFA
SLLTRGSKGEYQIKMENFDKTVPELPTALVSKNPNRTDLDIRINGQSIDNFQISETGLTE
Download sequence
Identical sequences H0X1D7
ENSOGAP00000008802 XP_003784903.1.62490 XP_012657710.1.62490 ENSOGAP00000008802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]