SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008858 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008858
Domain Number 1 Region: 91-317
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.16e-44
Family Voltage-gated potassium channels 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008858   Gene: ENSOGAG00000009901   Transcript: ENSOGAT00000009908
Sequence length 856
Comment pep:known_by_projection scaffold:OtoGar3:GL873542.1:22132965:22193286:-1 gene:ENSOGAG00000009901 transcript:ENSOGAT00000009908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQKSRNGGVYPGPSGEKKLKVGFVGLDPGAPDSTRDGALLIAGSEAPKRGSILSKPRAG
GAGAGKPPKRNAFYRKLQNFLYNVLERPRGWAFIYHAYVFLLVFSCLVLSVFSTIKEYEK
SSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGWRGRLKFARKPFCVIDIMVLIASI
AVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYIGF
LCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYGDKYPQTWNGRLLAATFTLI
GVSFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAAGLIQAAWRFYATNLSRTDLHSTW
QYYERTVTVPMYSSQTQTYGASRLIPPLNQLELLRNLKSKSGLTFRKEPQPEPSPRSSQK
VSLKDRVFSSPRGVAAKGKGSPQAQTVRRSPSADQSLEDSPSKVPKSWSFGDRSRARQAF
RIKGAASRQNSEEASLPGEDVVDDKTCNCEFVTEDLTPGLKVSIRAVCVMRFLVSKRKFK
ESLRPYDVMDVIEQYSAGHLDMLSRIKSLQSRVDQIVGRGPAITDKDRTKGPTEAELPED
PSMMGRLGKVERQVLSMEKKLDFLVNIYMQRMGIPPTETEAYFGAKDPEPAPPYHSPEDS
REPVDKHGCIIKIVRSTSSTGQKNFSALPAAPPAQCPPSTSWQQQSHSRQGHGTSPVGDH
GSLVRIPPPPAHERSLSAYGGGSRASTEFLRQEDAPACRAHEGALRDSDTSISIPSVDHE
ELERSFSGFSISQSKENLDALSSCYAAVAPCAKVRPYIAEGESDTDSDLCTPCGPPPRSA
TGEGPFGDMGWPGPRK
Download sequence
Identical sequences H0X1I7
ENSOGAP00000008858 ENSOGAP00000008858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]