SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008877 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008877
Domain Number 1 Region: 288-417
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.62e-43
Family Regulator of G-protein signaling, RGS 0.000022
Further Details:      
 
Domain Number 2 Region: 1-95
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.03e-28
Family DEP domain 0.011
Further Details:      
 
Domain Number 3 Region: 215-277
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 1.7e-17
Family Transducin (heterotrimeric G protein), gamma chain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008877   Gene: ENSOGAG00000009927   Transcript: ENSOGAT00000009932
Sequence length 444
Comment pep:known_by_projection scaffold:OtoGar3:GL873684.1:709934:960810:1 gene:ENSOGAG00000009927 transcript:ENSOGAT00000009932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFP
ISDHVLTLKDDGTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESL
ARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVD
IKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELHQQIKYWQIQLDRHR
LKMSKVADSLLSYTEQYVEYDPFLVPPDPSNPWLSDDTTFWELEASKEPSQQRVKRWGFG
MDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGA
PSAINLDSKSYDKTTQNVKEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKK
GRNLPIFPCHKNCTPTLRASTNLL
Download sequence
Identical sequences H0X1K4
ENSOGAP00000008877 ENSOGAP00000008877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]