SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008887 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008887
Domain Number 1 Region: 1-162,264-371
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.45e-42
Family FAD-linked reductases, N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008887   Gene: ENSOGAG00000009938   Transcript: ENSOGAT00000009945
Sequence length 470
Comment pep:known_by_projection scaffold:OtoGar3:GL873684.1:289759:328296:-1 gene:ENSOGAG00000009938 transcript:ENSOGAT00000009945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGSLNACFLAKRNFQVDIYEAREDIRVATFTRGRSINLALSHRGRQALKAVGLEEQIVSQ
GIPMKARMIHSLSGKKSAIPYGTRSQYILSISRESLSKDLLTAVEKYPNVKVHFGHKLLK
CNPEEGMITVLGSDKVLKDVTYDLIVGCDGAYSTVRTYLIKKPRFDYSQKYIPHGYMELT
IPPKHGDFAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEEYEKLLTSNDVLDFFQ
KYFPDAIPLIGETALVQDFFLLPAQPLISVKCSSFHFKSHCVLMGDAAHAIVPFLGQGMN
AGFEDCLVFDELMDKFNNDLSLCLPAFSRLRIPDNHAISDLSMYNYIEMRAHVNSRWFIF
QKNIVRFLHAIMPSTFIPLYTMVVFSRMRYHEAVLHWHWQKKVINKGLFFLGSLTAIGST
YLLMHYLPPRLLDSLRRPWDWITYFWNTEYYFPTNSMEALSRQVPVLLSK
Download sequence
Identical sequences H0X1L0
ENSOGAP00000008887 ENSOGAP00000008887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]