SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008894 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008894
Domain Number 1 Region: 132-215
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000000000868
Family Extracellular domain of cell surface receptors 0.053
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000008894
Domain Number - Region: 17-110
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000269
Family Snake venom toxins 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008894   Gene: ENSOGAG00000009950   Transcript: ENSOGAT00000009954
Sequence length 251
Comment pep:known_by_projection scaffold:OtoGar3:GL873671.1:1234346:1238088:-1 gene:ENSOGAG00000009950 transcript:ENSOGAT00000009954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAMGVPRAILLCFFVAVLCLTGSRALQCYSFEHTYFGPFDLSAMKLPSVFCPYGCFEAIL
SLDTGYRAPVTMVQKGCWTGPPTGQMQSNQDALPPDFSVVRGCASDWCNANLVTHDSIPN
LSQAPDPQTLSGTECYSCVGILPEDCAPEKSRRVQCHQGQNVCFQGNGRMAIGNFSVPVY
IRTCHRPSCTTEGTTSPWTDIDLQGSCCKGNFCNQDSVTQPFTTASATVPSLAPQVRALL
LTVLLLPGLSV
Download sequence
Identical sequences H0X1L6
ENSOGAP00000008894 ENSOGAP00000008894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]