SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008921 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008921
Domain Number 1 Region: 147-229
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.09e-16
Family Platelet-derived growth factor-like 0.021
Further Details:      
 
Domain Number 2 Region: 2-61
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000432
Family Spermadhesin, CUB domain 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000008921
Domain Number - Region: 117-158
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0335
Family Serine carboxypeptidase-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008921   Gene: ENSOGAG00000009984   Transcript: ENSOGAT00000009989
Sequence length 247
Comment pep:known_by_projection scaffold:OtoGar3:GL873877.1:155311:233885:1 gene:ENSOGAG00000009984 transcript:ENSOGAT00000009989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYDFVEVEDISETSTVIRGWWCGHKEVLPRITSRTNQIKITFKSDDYFVSKPGFKIYYSF
VEDFQPAAASETNWESVTSSISGVSYHSPSVTDPTLTADALDKTIAEFDTVEDLLKHFNP
ESWQEDLENLYLDTPRYRGRSYHDQKSKVDLDRLNEDVRRYSCTPRNYSVNLREELKLTS
VVFFPRCLLVQRCGGNCGCGTANWKSCTCNSGKTVKKYHEVLKFEPGHFRRRGRAKTMAL
VDIQLDH
Download sequence
Identical sequences H0X1P0
ENSOGAP00000008921 ENSOGAP00000008921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]